DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab13

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_112354.1 Gene:Rab13 / 81756 RGDID:620880 Length:203 Species:Rattus norvegicus


Alignment Length:197 Identity:124/197 - (62%)
Similarity:156/197 - (79%) Gaps:5/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68
            |.||.||||||||||||||||::.||::|.|.||:||||||||||:|||:.||:||||:||||||
  Rat     3 KAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVEIEGKRIKLQVWDTAGQ 67

  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
            |||.||||:||||||||:||||||:|||||||..|:::|.|:|:..||:::|||||||..||.|.
  Rat    68 ERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQ 132

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQ-----ERVIIDRRNQ 193
            :|:.|.:||||.|||.||||||::|::.||..||..||.||.||.|..:.     :..:.|::|.
  Rat   133 REQAERLAREHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGNSSKPSSTDLKVSDKKNS 197

  Fly   194 EK 195
            .|
  Rat   198 NK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 114/165 (69%)
Rab13NP_112354.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 114/165 (69%)
Effector region. /evidence=ECO:0000250 37..45 6/7 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..203 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X312
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.