Sequence 1: | NP_523419.1 | Gene: | Rab10 / 33025 | FlyBaseID: | FBgn0015789 | Length: | 204 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002857.1 | Gene: | RAB3A / 5864 | HGNCID: | 9777 | Length: | 220 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 96/204 - (47%) |
---|---|---|---|
Similarity: | 140/204 - (68%) | Gaps: | 7/204 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68
Fly 69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
Fly 134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRR-----NQ 193
Fly 194 EKAPGYSKC 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab10 | NP_523419.1 | Rab8_Rab10_Rab13_like | 7..173 | CDD:206659 | 90/165 (55%) |
RAB3A | NP_002857.1 | Rab3 | 22..186 | CDD:206657 | 89/163 (55%) |
Effector region. /evidence=ECO:0000250 | 51..59 | 5/7 (71%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..220 | 2/25 (8%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1426655at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |