DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and zgc:162879

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001082896.1 Gene:zgc:162879 / 572256 ZFINID:ZDB-GENE-070424-92 Length:663 Species:Danio rerio


Alignment Length:206 Identity:80/206 - (38%)
Similarity:120/206 - (58%) Gaps:12/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TYDL--LFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAG 67
            |.||  :::|:|.||:|.||:..|.|.|.:.|.....:|:|:||:||.:.:.|:|..||||||||
Zfish   461 TQDLAPVYRLVLAGDAGSGKSSFLLRLSLNEFRGDIQTTLGVDFQIKKMLVDGEKTNLQIWDTAG 525

  Fly    68 QERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKR-- 130
            ||||.:|..||:|.|.|::|:||:|:|.||.|:.:|:..|.|..:||:...|:|||.|:...|  
Zfish   526 QERFRSIARSYFRKAHGVLLLYDVTSESSFLNVREWVEQIRESTDEDIPMCIIGNKVDLRAARPE 590

  Fly   131 --VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTS-GRESAENQERVIIDRRN 192
              .|:...||.:|..:...|.|.|||...::..|...||..:..... ||.| |:|.::.:.:|.
Zfish   591 GSCVSSIHGEKLAMNYNALFCEASAKEGTSVIEAVLHLAREVKKHVKLGRRS-ESQVKLSLHKRR 654

  Fly   193 QEKAPGYSKCC 203
            :.    .|.||
Zfish   655 KT----LSNCC 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 70/171 (41%)
zgc:162879NP_001082896.1 EFh 5..60 CDD:238008
EF-hand_7 6..60 CDD:290234
TMPIT 104..>187 CDD:285135
RILP-like <180..290 CDD:304877
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..343
RAB 468..634 CDD:197555 68/165 (41%)
Rab 468..630 CDD:206640 67/161 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.