DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rasef

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_699335.4 Gene:rasef / 570731 ZFINID:ZDB-GENE-081105-157 Length:706 Species:Danio rerio


Alignment Length:202 Identity:70/202 - (34%)
Similarity:114/202 - (56%) Gaps:13/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTI 74
            ::::|.||:.|||:..|.|...:.|.....:|:|:||::||:.:.|....||:|||||||||.:|
Zfish   508 YRIVLAGDAAVGKSSFLLRLCKNEFKGNTSATLGVDFQMKTLVVDGVPTVLQLWDTAGQERFRSI 572

  Fly    75 TTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRV------VN 133
            ..||:|.|.|::|:||:|.||||.|:.:|:..|::.:.:|:..|::|||.|:..:.:      :.
Zfish   573 AKSYFRRADGVLLLYDVTCEKSFLNVREWVDIIEDVSQDDIPIMLVGNKTDLRKEALQDGVTCIP 637

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDR--RNQEKA 196
            ...||.:|..:...|.|||||...||..|...||..:.     :.:.:.:|.|.:.:  .|..|.
Zfish   638 TSYGEKLAMTYSALFCETSAKDGSNIIEAVLHLAREVT-----KHADDYKEPVSVAKLSGNHTKK 697

  Fly   197 PGYSKCC 203
            .....||
Zfish   698 MSSPNCC 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 64/168 (38%)
rasefXP_699335.4 EFh 9..69 CDD:238008
EF-hand_7 10..68 CDD:290234
DUF904 201..>253 CDD:283624
RAB 508..674 CDD:197555 64/165 (39%)
Rab 508..672 CDD:206640 63/163 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.