| Sequence 1: | NP_523419.1 | Gene: | Rab10 / 33025 | FlyBaseID: | FBgn0015789 | Length: | 204 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009298523.1 | Gene: | cracr2ab / 564347 | ZFINID: | ZDB-GENE-041210-94 | Length: | 773 | Species: | Danio rerio |
| Alignment Length: | 195 | Identity: | 72/195 - (36%) |
|---|---|---|---|
| Similarity: | 112/195 - (57%) | Gaps: | 9/195 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 LFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHT 73
Fly 74 ITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGE 138
Fly 139 AIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEKAPGYSKCC 203
Fly 204 203 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Rab10 | NP_523419.1 | Rab8_Rab10_Rab13_like | 7..173 | CDD:206659 | 66/163 (40%) |
| cracr2ab | XP_009298523.1 | EFh | 46..106 | CDD:238008 | |
| EF-hand_7 | 47..98 | CDD:290234 | |||
| FAM184 | 210..390 | CDD:292293 | |||
| RAB | 587..745 | CDD:197555 | 64/157 (41%) | ||
| Rab | 587..745 | CDD:206640 | 64/157 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||