DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab44

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_689291.6 Gene:rab44 / 560799 ZFINID:ZDB-GENE-040724-117 Length:2402 Species:Danio rerio


Alignment Length:194 Identity:83/194 - (42%)
Similarity:119/194 - (61%) Gaps:9/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTI 74
            |.::::|:|.||||..:.||.:..||..:.||||:|..::||||..:.:||||||||||||||:|
Zfish  2218 FNVVMVGNSCVGKTSFIRRFHEGQFTEDYRSTIGVDTFVQTVELPDRTVKLQIWDTAGQERFHSI 2282

  Fly    75 TTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEA 139
            ||..:..|.|::|:|:||..|||.:|..|:....|.|.:||..|:||||.|..::.|..:| |..
Zfish  2283 TTQVFHKAEGLLLMYEITCSKSFISIRDWISQARERAQDDVVMMLLGNKNDSVNREVQIQE-GAD 2346

  Fly   140 IAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEKAPGYSKCC 203
            :|||:.|.|||.||.:..|:..:...|||.::.:...||     |...:.|..|:|..|   ||
Zfish  2347 LAREYNIHFMECSAANGANVSESMRTLAELLVQRKRKRE-----EHTTLRREPQQKKSG---CC 2402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 74/162 (46%)
rab44XP_689291.6 EIN3 <1419..>1534 CDD:296674
RAB 2218..2380 CDD:197555 74/162 (46%)
Rab 2218..2375 CDD:206640 72/157 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.