DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab3aa

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001003419.1 Gene:rab3aa / 445024 ZFINID:ZDB-GENE-040801-2 Length:220 Species:Danio rerio


Alignment Length:181 Identity:93/181 - (51%)
Similarity:133/181 - (73%) Gaps:1/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTA 66
            |::.:|.:||:|:||:|.||||..|||::||:||..|:||:|||||:||:....|:|||||||||
Zfish    15 AEQNFDYMFKVLIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTA 79

  Fly    67 GQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRV 131
            ||||:.||||:|||||||.:|:||||||.||..:..|...|..::.::.:.:::||||||.|:||
Zfish    80 GQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERV 144

  Fly   132 VNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTS-GRESAE 181
            |..:||..::.:.|..|.|.|||.|||:::.|..|.:.|.::.| ..|||:
Zfish   145 VAGQRGRQLSEQLGFEFFEASAKDNINVKQTFERLVDVICERMSENLESAD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 88/165 (53%)
rab3aaNP_001003419.1 Rab3 22..186 CDD:206657 87/163 (53%)
RAB 23..183 CDD:197555 86/159 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.