DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and RabX1

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster


Alignment Length:163 Identity:55/163 - (33%)
Similarity:92/163 - (56%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLLLIGDSGVGKTCILFRFSDDAF--TSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHT 73
            |:|::|..|||||.::.|:..:..  ..:.:.||.:.|....:.|...||||||||||||||:..
  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71

  Fly    74 ITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGE 138
            :...|||.|...:||:|:|..|:|..|..|::.:..:..:.:...::|||.||..:|.|::|...
  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREEAF 136

  Fly   139 AIAREHGIRFMETSAKSNINIERAFCELAEAIL 171
            ..|...|..:.|||.:::..:|:.|...|:.::
  Fly   137 VFATSIGATYFETSTETDQGLEQVFISTAQGLV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 55/163 (34%)
RabX1NP_524713.1 Ras 7..166 CDD:278499 54/158 (34%)
Rab 7..166 CDD:206640 54/158 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.