DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab23

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:167 Identity:60/167 - (35%)
Similarity:100/167 - (59%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDT 65
            |.:...:|..|::::|:.||||:.::.|:....||..:..|||:||..:.:|:.|:.:::.:|||
  Fly    29 MREDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDT 93

  Fly    66 AGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKR 130
            ||||.|..||.:|||||...:||:..|:..||:.|..|.|.::...|| :..:|:.||.|:.::.
  Fly    94 AGQEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVENECNE-IPTVIVQNKIDLIEQA 157

  Fly   131 VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELA 167
            ||..:..|.:|:....|.:.||.|.:||:...|..||
  Fly   158 VVTADEVETLAKLLNCRLIRTSVKEDINVASVFRYLA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 59/161 (37%)
Rab23NP_649574.1 Ras 50..199 CDD:278499 53/146 (36%)
Rab23_like 50..197 CDD:133306 53/146 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.