DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and RAB44

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001244286.1 Gene:RAB44 / 401258 HGNCID:21068 Length:1021 Species:Homo sapiens


Alignment Length:198 Identity:68/198 - (34%)
Similarity:116/198 - (58%) Gaps:7/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERF 71
            |.||.::.:|||.||||..|.....::|.:...:|:|:||::||:.:..|...||:||||||||:
Human   831 DYLFHVIFLGDSNVGKTSFLHLLHQNSFATGLTATVGVDFRVKTLLVDNKCFVLQLWDTAGQERY 895

  Fly    72 HTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER 136
            |::|....|.|.|::|:||||:::||.::..||..:.:..::.|..::||||.|..::|.|:.|.
Human   896 HSMTRQLLRKADGVVLMYDITSQESFAHVRYWLDCLQDAGSDGVVILLLGNKMDCEEERQVSVEA 960

  Fly   137 GEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEKAPGYSK 201
            |:.:|:|.|:.|.|.||....||......||.::..:..|.:.:       :.:...::.|....
Human   961 GQQLAQELGVYFGECSAALGHNILEPVVNLARSLRMQEEGLKDS-------LVKVAPKRPPKRFG 1018

  Fly   202 CCA 204
            ||:
Human  1019 CCS 1021

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 64/165 (39%)
RAB44NP_001244286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
EF-hand_8 59..102 CDD:316358
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..133
SMC_N <191..>337 CDD:330553
Atrophin-1 <326..647 CDD:331285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..405
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..483
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..827
DNA_pol3_gamma3 <523..831 CDD:331207 68/198 (34%)
Rab 834..992 CDD:206640 61/157 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.