Sequence 1: | NP_523419.1 | Gene: | Rab10 / 33025 | FlyBaseID: | FBgn0015789 | Length: | 204 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001244286.1 | Gene: | RAB44 / 401258 | HGNCID: | 21068 | Length: | 1021 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 68/198 - (34%) |
---|---|---|---|
Similarity: | 116/198 - (58%) | Gaps: | 7/198 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERF 71
Fly 72 HTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER 136
Fly 137 GEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEKAPGYSK 201
Fly 202 CCA 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab10 | NP_523419.1 | Rab8_Rab10_Rab13_like | 7..173 | CDD:206659 | 64/165 (39%) |
RAB44 | NP_001244286.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..40 | ||
EF-hand_8 | 59..102 | CDD:316358 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 113..133 | ||||
SMC_N | <191..>337 | CDD:330553 | |||
Atrophin-1 | <326..647 | CDD:331285 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 339..405 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 419..483 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 495..827 | ||||
DNA_pol3_gamma3 | <523..831 | CDD:331207 | 68/198 (34%) | ||
Rab | 834..992 | CDD:206640 | 61/157 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |