DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab35

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_989019.1 Gene:rab35 / 394615 XenbaseID:XB-GENE-489018 Length:201 Species:Xenopus tropicalis


Alignment Length:204 Identity:91/204 - (44%)
Similarity:143/204 - (70%) Gaps:9/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68
            :.||.|||||:||||||||:.:|.||:|:.|:.::|:|||:||||:|||:.|:|:||||||||||
 Frog     3 RDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQ 67

  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
            |||.|||::||||..|:::|||:|:.:||.|:.:||..|:::. :||.::::|||.|..:::||.
 Frog    68 ERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNC-DDVCRILVGNKNDDPERKVVE 131

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAIL----DKTSGRESAENQERVIIDRRNQE 194
            .|.....|.:..|:..|||||.|:|:|..|..:.|.:|    |..:.::..:..:.|.:.:.::.
 Frog   132 TEDAYKFAAQMDIQLFETSAKENLNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLSKNSKR 196

  Fly   195 KAPGYSKCC 203
            |    .:||
 Frog   197 K----KRCC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 85/169 (50%)
rab35NP_989019.1 Rab35 3..201 CDD:133310 89/202 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.