Sequence 1: | NP_523419.1 | Gene: | Rab10 / 33025 | FlyBaseID: | FBgn0015789 | Length: | 204 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001295083.1 | Gene: | RAB15 / 376267 | HGNCID: | 20150 | Length: | 212 | Species: | Homo sapiens |
Alignment Length: | 211 | Identity: | 105/211 - (49%) |
---|---|---|---|
Similarity: | 152/211 - (72%) | Gaps: | 9/211 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDT 65
Fly 66 AGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKR 130
Fly 131 VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILD----KTSGRESAENQERVIIDRR 191
Fly 192 NQEKAP----GYSKCC 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab10 | NP_523419.1 | Rab8_Rab10_Rab13_like | 7..173 | CDD:206659 | 94/169 (56%) |
RAB15 | NP_001295083.1 | Rab15 | 9..172 | CDD:206698 | 92/162 (57%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..212 | 5/18 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |