DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab13

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_958486.1 Gene:rab13 / 373105 ZFINID:ZDB-GENE-030826-30 Length:200 Species:Danio rerio


Alignment Length:202 Identity:126/202 - (62%)
Similarity:160/202 - (79%) Gaps:5/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDT 65
            |||| ||.||||||||||||||||::.||::|.|.||:|||||||||:||:|:.|||:|||:|||
Zfish     1 MAKK-YDFLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDT 64

  Fly    66 AGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKR 130
            ||||||.||||:||||||||:||||||:|||:|||..|:::|.|:|:..|.:|:||||||:..||
Zfish    65 AGQERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIKENASAGVSRMLLGNKCDIEAKR 129

  Fly   131 VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEK 195
            .|:||.||.:|:||||||.||||||:||:|.:|..||..||.|::.:.....:|   :...:.||
Zfish   130 KVSKETGEKLAKEHGIRFFETSAKSSINVEESFTSLARDILLKSNKKPGPSGRE---VKLTSTEK 191

  Fly   196 APGYSKC 202
            ... |||
Zfish   192 KSS-SKC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 114/165 (69%)
rab13NP_958486.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 114/165 (69%)
RAB 9..170 CDD:197555 110/160 (69%)
Effector region. /evidence=ECO:0000250 37..45 6/7 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195 3/25 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.