DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab32

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:185 Identity:65/185 - (35%)
Similarity:106/185 - (57%) Gaps:9/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKI-KLQIWDTAGQERFH 72
            |:|:|:||:.|.|||..:.|:....|:..:.:|||:||.:|.::.....| :||:||.||||||.
  Fly   483 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFG 547

  Fly    73 TITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHA----NEDVEKMILGNKCDMTDKRVVN 133
            .:|..||:.|:|..:|:|:|...:|:.:.||..::|...    ...:..::|.||||...:.::.
  Fly   548 NMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIIT 612

  Fly   134 K-ERGEAIAREHGIR-FMETSAKSNINIERAFCELAEAIL--DKTSGRESAENQE 184
            : |:.:...||:|.. :.|||||.||||:.|...|...||  ||....:.|:..:
  Fly   613 QPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKLISADLADGDK 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 62/172 (36%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 64/184 (35%)
RAB 484..652 CDD:197555 59/167 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.