DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab21

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:209 Identity:71/209 - (33%)
Similarity:118/209 - (56%) Gaps:13/209 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELR-GKKIKLQIWDTAGQERF 71
            |.||.:|:|:..||||.::.|:.:|.|.:..:||:...|..:.:.|. |::.:|.||||||||||
  Fly    12 LNFKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERF 76

  Fly    72 HTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER 136
            |.:...||||:.|.:||||||:..||:.:..|:|.:.:....::..:|:|||.|:.::|.|..:.
  Fly    77 HALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDE 141

  Fly   137 GEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRE------SAENQERVIIDRRNQEK 195
            ....||..|.:::|||||.|..:...|..|.:.:|::.|.|:      ..:|.:...::..:..:
  Fly   142 ALQYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASPLRLQNPDTDNLNNSDDSE 206

  Fly   196 AP------GYSKCC 203
            ||      |...||
  Fly   207 APDPGDPAGQRSCC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 63/165 (38%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 61/161 (38%)
Ras 15..177 CDD:278499 60/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.