DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab35

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster


Alignment Length:198 Identity:95/198 - (47%)
Similarity:136/198 - (68%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQER 70
            :|.|||||:||||||||:.:|.|||||.|:.::|:|||:||||:||::.|.::||||||||||||
  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQER 69

  Fly    71 FHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKE 135
            |.|||::||||..|:::|||:||.:||.|:.:||..|..:. :.|:|:::|||.|..|::||..|
  Fly    70 FRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC-DVVKKVLVGNKNDDPDRKVVITE 133

  Fly   136 RGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEKAPGYS 200
            ..:..|::..|...|||||.|||:|..|..:...:||... |.|...|::..:..:...|.....
  Fly   134 DAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKL-RTSPNEQQKDTLHLKPNPKGSKGG 197

  Fly   201 KCC 203
            |||
  Fly   198 KCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 87/165 (53%)
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 95/198 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.