DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab9D

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_727432.1 Gene:Rab9D / 318149 FlyBaseID:FBgn0067052 Length:197 Species:Drosophila melanogaster


Alignment Length:164 Identity:72/164 - (43%)
Similarity:101/164 - (61%) Gaps:2/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKI--KLQIWDTAGQ 68
            ||..||::|:|||||||||:|.||||:.||:...||:|:|.:..:||....::  .||:|||:..
  Fly     4 YDNPFKIILLGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRMGRMLQVWDTSDD 68

  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
            |||..:..:..|.|.||:||||||:.|||:||..|::.|.....:.|..:::|||.|..:.|.|:
  Fly    69 ERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKEIRRLCPDKVIVLLVGNKSDDPNHRQVS 133

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELA 167
            ..:|...|....|.|.|.||||..|:...|..||
  Fly   134 MAQGFNYAHRQSICFEEVSAKSGRNVYDIFSSLA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 71/163 (44%)
Rab9DNP_727432.1 RAB 8..171 CDD:197555 70/160 (44%)
Rab 8..167 CDD:206640 68/158 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.