DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab40b

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001100546.1 Gene:Rab40b / 303754 RGDID:1305663 Length:279 Species:Rattus norvegicus


Alignment Length:168 Identity:79/168 - (47%)
Similarity:104/168 - (61%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68
            :.||.|.|.||:|||.|||..||....|.|..|.:....|||.|..|:.|.|:::|||:|||:||
  Rat    10 RAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDHKTTTILLDGRRVKLQLWDTSGQ 74

  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
            .||.||..||.|||.|::|||||.|..||:.|.:|::.||||| ..|.|:::||:..:..||.|.
  Rat    75 GRFCTIFRSYSRGAQGVILVYDIANRWSFDGINRWIKEIDEHA-PGVPKILVGNRLHLAFKRQVP 138

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAIL 171
            .|:.:|.|...|:.|.|.|...|.||..:|.|||..:|
  Rat   139 TEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 78/165 (47%)
Rab40bNP_001100546.1 Rab40 10..279 CDD:133321 79/168 (47%)
SOCS_Rab40 188..230 CDD:239711
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.