DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab3a

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_037150.2 Gene:Rab3a / 25531 RGDID:3528 Length:220 Species:Rattus norvegicus


Alignment Length:204 Identity:97/204 - (47%)
Similarity:140/204 - (68%) Gaps:7/204 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68
            :.:|.:||:|:||:|.||||..|||::||:||..|:||:|||||:||:....|:|||||||||||
  Rat    17 QNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQ 81

  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
            ||:.||||:|||||||.:|:||||||:||..:..|...|..::.::.:.:::||||||.|:|||:
  Rat    82 ERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVS 146

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRR-----NQ 193
            .|||..:|...|..|.|.|||.|||:::.|..|.:.|.:|.|  ||.:..:..:...:     ..
  Rat   147 SERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMS--ESLDTADPAVTGAKQGPQLTD 209

  Fly   194 EKAPGYSKC 202
            ::||.:..|
  Rat   210 QQAPPHQDC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 90/165 (55%)
Rab3aNP_037150.2 Rab3 22..186 CDD:206657 89/163 (55%)
Effector region. /evidence=ECO:0000250 51..59 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..220 3/25 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.