DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab40b

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_036012513.1 Gene:Rab40b / 217371 MGIID:2183451 Length:308 Species:Mus musculus


Alignment Length:197 Identity:79/197 - (40%)
Similarity:104/197 - (52%) Gaps:30/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIW----- 63
            :.||.|.|.||:|||.|||..||....|.|..|.:....|||.|..|:.|.|:::|||:|     
Mouse    10 RAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDHKTTTILLDGRRVKLQLWKPGLF 74

  Fly    64 ------------------------DTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWL 104
                                    ||:||.||.||..||.|||.|::|||||.|..||:.|.:|:
Mouse    75 YCTLPEASGTRTMLKNNQSQKLERDTSGQGRFCTIFRSYSRGAQGVVLVYDIANRWSFDGINRWI 139

  Fly   105 RNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEA 169
            :.||||| ..|.|:::||:..:..||.|..|:.:|.|...|:.|.|.|...|.||..:|.|||..
Mouse   140 KEIDEHA-PGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARI 203

  Fly   170 IL 171
            :|
Mouse   204 VL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 78/194 (40%)
Rab40bXP_036012513.1 P-loop_NTPase 10..308 CDD:422963 79/197 (40%)
SOCS 217..259 CDD:413360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.