DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab10

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_057885.1 Gene:Rab10 / 19325 MGIID:105066 Length:200 Species:Mus musculus


Alignment Length:205 Identity:163/205 - (79%)
Similarity:177/205 - (86%) Gaps:7/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDT 65
            ||||||||||||||||||||||||:|||||||||.:|||||||||||||||||:|||||||||||
Mouse     1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDT 65

  Fly    66 AGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKR 130
            ||||||||||||||||||||||||||||.||||||.|||||||||||||||:|:|||||||.|||
Mouse    66 AGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKR 130

  Fly   131 VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRE-SAENQERVIIDRRNQE 194
            ||.|.:||.|||||||||.|||||:|||||:||..|||.||.||..:| ::||     :|..:..
Mouse   131 VVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSEN-----VDISSGG 190

  Fly   195 KAPGY-SKCC 203
            ...|: ||||
Mouse   191 GVTGWKSKCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 146/165 (88%)
Rab10NP_057885.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 146/165 (88%)
Effector region. /evidence=ECO:0000250 38..46 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 287 1.000 Domainoid score I1588
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41111
Inparanoid 1 1.050 313 1.000 Inparanoid score I2554
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - oto92068
orthoMCL 1 0.900 - - OOG6_107709
Panther 1 1.100 - - LDO PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.