DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab-28

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_501609.1 Gene:rab-28 / 189429 WormBaseID:WBGene00004281 Length:248 Species:Caenorhabditis elegans


Alignment Length:198 Identity:58/198 - (29%)
Similarity:102/198 - (51%) Gaps:8/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVEL-RGKKIKLQIWDTAGQER 70
            |.:.|::::||...|||.|..||:.::|..::..|:|:||..:.:.| ...::.:|:||..||..
 Worm    33 DKVIKIVVVGDGASGKTSICQRFAKESFDKSYHQTLGLDFFSRRITLPHEMQVLVQVWDIGGQSI 97

  Fly    71 FHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANED---VEKMILGNKCDMTDKRVV 132
            ...:...|..||..:.||||:||.|||||.|.||..:.::....   |:.:::|||.|:.::|||
 Worm    98 AGEMIDKYLTGANIVFLVYDVTNSKSFENAVDWLSVVKKNTKSSETPVKLVLMGNKTDLEERRVV 162

  Fly   133 NKERGEAIAREHGIRFMETSAKSN----INIERAFCELAEAILDKTSGRESAENQERVIIDRRNQ 193
            :.|..:..|..:.:.....|||:.    :...:|..|:....|.:.......|..:..:|::..|
 Worm   163 SVEAHKNFATSNDMMPTYVSAKTGDTVFLTFRQAVAEVLNVGLSRAEVEADIEIVQGSVIEQPKQ 227

  Fly   194 EKA 196
            ..|
 Worm   228 SDA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 54/173 (31%)
rab-28NP_501609.1 Rab28 36..248 CDD:206694 57/195 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.