DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab-1

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_503397.1 Gene:rab-1 / 178620 WormBaseID:WBGene00004266 Length:205 Species:Caenorhabditis elegans


Alignment Length:200 Identity:109/200 - (54%)
Similarity:147/200 - (73%) Gaps:4/200 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQER 70
            ||.||||||||||||||:|:|.||:||.:|.::|||||:||||:|:||.||.|||||||||||||
 Worm     8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQER 72

  Fly    71 FHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKE 135
            |.|||:||||||.||::|||||::::|.|:.:||:.||.:|.|:|.|:::|||||:|.||.|..:
 Worm    73 FRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTAKRAVETQ 137

  Fly   136 RGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQE--RVIIDRRNQEKAPG 198
            ..:..|.:.||.|:||||||:.|:|:||..:|..|..:....:.|....  |:...:..|:|..|
 Worm   138 AAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSRMGPVQGAGGAPGVRITGSQPVQDKKSG 202

  Fly   199 YSKCC 203
              .||
 Worm   203 --GCC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 101/165 (61%)
rab-1NP_503397.1 Rab1_Ypt1 10..175 CDD:206661 100/164 (61%)
RAB 12..175 CDD:197555 99/162 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.