DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Y71H2AM.12

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_497608.1 Gene:Y71H2AM.12 / 175389 WormBaseID:WBGene00022177 Length:195 Species:Caenorhabditis elegans


Alignment Length:197 Identity:73/197 - (37%)
Similarity:115/197 - (58%) Gaps:16/197 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELR-GKKIKLQIWDTAGQERFHTI 74
            |::::|:||.|||.:|..|.|:.|.:..::|||||||.|.|:|. |:.|:||:|||||||||..:
 Worm     8 KVVVVGESGAGKTALLTCFLDNTFETDPLTTIGIDFKHKIVQLNDGQSIRLQLWDTAGQERFRQL 72

  Fly    75 TTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEA 139
            ..:|.|.|...:||.|:::|...|::::|...||::.::....:|:|||.|:..::  ...|..|
 Worm    73 APAYIRSARVALLVIDLSDENCVEHLIRWKGIIDKNKSDFTSTIIVGNKHDLVSEK--RSPRLTA 135

  Fly   140 IAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVII---DRRNQEKAPGYSK 201
            |.||....::|||||...||::.|..:|        .|...|::...||   :.|..|.|.  .:
 Worm   136 IIRETNDEYIETSAKMRKNIKKLFSSVA--------CRPFPEHETSQIILLNEPRPVESAT--KR 190

  Fly   202 CC 203
            ||
 Worm   191 CC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 64/162 (40%)
Y71H2AM.12NP_497608.1 Ras 13..163 CDD:278499 62/151 (41%)
Rab 13..163 CDD:206640 62/151 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.