DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab3c

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_598220.1 Gene:Rab3c / 171058 RGDID:620923 Length:227 Species:Rattus norvegicus


Alignment Length:183 Identity:99/183 - (54%)
Similarity:134/183 - (73%) Gaps:2/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68
            :.:|.:||||:||:|.||||..|||::||:|||.|:||:|||||:|||....|:|||||||||||
  Rat    25 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQ 89

  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
            ||:.||||:|||||||.:|:||||||:||..:..|...|..::.::.:.:::||||||.|:|||:
  Rat    90 ERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVVS 154

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERV 186
            .|||..:..:.|..|.|||||.|||:::.|..|.:.|.||.|  ||.|....:
  Rat   155 TERGRHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMS--ESLETDPAI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 93/165 (56%)
Rab3cNP_598220.1 Rab3 30..194 CDD:206657 92/163 (56%)
RAB 31..191 CDD:197555 91/159 (57%)
Effector region. /evidence=ECO:0000250 59..67 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.