Sequence 1: | NP_523419.1 | Gene: | Rab10 / 33025 | FlyBaseID: | FBgn0015789 | Length: | 204 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689786.2 | Gene: | RASEF / 158158 | HGNCID: | 26464 | Length: | 740 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 76/200 - (38%) |
---|---|---|---|
Similarity: | 119/200 - (59%) | Gaps: | 9/200 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 FKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTI 74
Fly 75 TTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER--- 136
Fly 137 ---GEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRRNQEKAPG 198
Fly 199 YSKCC 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab10 | NP_523419.1 | Rab8_Rab10_Rab13_like | 7..173 | CDD:206659 | 70/168 (42%) |
RASEF | NP_689786.2 | EFh | 12..71 | CDD:238008 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 82..110 | ||||
SMC_N | <174..>351 | CDD:330553 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 376..403 | ||||
Rab | 542..706 | CDD:206640 | 69/163 (42%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 713..740 | 4/25 (16%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |