DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab28

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_446430.1 Gene:Rab28 / 117049 RGDID:620891 Length:221 Species:Rattus norvegicus


Alignment Length:214 Identity:66/214 - (30%)
Similarity:106/214 - (49%) Gaps:12/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGK-KIKLQIWDTA 66
            :::.|...|::::||...|||.:...|:.:.|...:..|||:||.::.:.|.|. .:.||:||..
  Rat     6 EESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIG 70

  Fly    67 GQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKW---LRNIDEHANEDVEKMILGNKCDMTD 128
            ||.....:...|..||.||:|||||||.:||||:..|   ::.:.|.:.......::|||.|:..
  Rat    71 GQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSEESETQPLVALVGNKIDLEH 135

  Fly   129 KRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVI---IDR 190
            .|.|..::.....:|:|......|||:..::...|.::|..||.....:...|..:||:   |..
  Rat   136 MRTVKPDKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVN 200

  Fly   191 RNQEKA-----PGYSKCCA 204
            .|||..     |..|..||
  Rat   201 YNQEPMSRTVNPPRSSMCA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 55/169 (33%)
Rab28NP_446430.1 Rab28 13..221 CDD:206694 65/207 (31%)
Effector region. /evidence=ECO:0000250 41..49 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.