DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and Rab15

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_598811.3 Gene:Rab15 / 104886 MGIID:1916865 Length:212 Species:Mus musculus


Alignment Length:211 Identity:105/211 - (49%)
Similarity:152/211 - (72%) Gaps:9/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDT 65
            |||: ||:||:|||||||||||||:|.||:|:.|.|:.|||||:|||:||:|:.|.|:::|||||
Mouse     1 MAKQ-YDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDT 64

  Fly    66 AGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKR 130
            |||||:.|||..|||.|.||.|||||::|:|:::|:||:.::||:|.|.|:|:::|||.|...||
Mouse    65 AGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKR 129

  Fly   131 VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILD----KTSGRESAENQERVIIDRR 191
            .|.:|:|:.:|:|:|:.|.||||.:|:||:.:|..|.|.:|.    :..|..:..:.|..:.:..
Mouse   130 QVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELDGLRTRASNELALAELE 194

  Fly   192 NQEKAP----GYSKCC 203
            ..|..|    ..||.|
Mouse   195 EDEGKPEGPANSSKTC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 94/169 (56%)
Rab15NP_598811.3 Rab15 9..172 CDD:206698 92/162 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..212 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.