DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and cracr2aa

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_002667614.5 Gene:cracr2aa / 100330395 ZFINID:ZDB-GENE-110427-1 Length:718 Species:Danio rerio


Alignment Length:198 Identity:80/198 - (40%)
Similarity:129/198 - (65%) Gaps:10/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERF 71
            |.|||::|:|:|.||||.:|.||.||.|.|...:|:|||:.:||:.:...:|.||:||||||||:
Zfish   530 DRLFKVVLVGNSSVGKTSLLRRFCDDCFHSGTCATVGIDYSVKTLSVDNSQIALQMWDTAGQERY 594

  Fly    72 HTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKER 136
            .:||..::|.|.|:::|||||||::|..:.:||.::.|.|.||:..|:||||.|:..:||:....
Zfish   595 RSITKQFFRKADGVVVVYDITNEQTFTAVRQWLASVQEGAGEDIPIMLLGNKTDLDSQRVIPLGL 659

  Fly   137 GEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERV-IIDRRNQEKAPGYS 200
            ||.:|::..:.|.|.||.||.|:..:...:|..:.:    :|..|.::.| ::|..:::|:    
Zfish   660 GEKLAKDFQLMFYECSAFSNHNVTDSMIHMARILKE----QEDREKEKTVSLVDSPSKKKS---- 716

  Fly   201 KCC 203
             ||
Zfish   717 -CC 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 73/165 (44%)
cracr2aaXP_002667614.5 EF-hand_7 35..97 CDD:316058
SMC_N <162..>371 CDD:330553
Rab 533..691 CDD:206640 70/157 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.