DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab10

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_031757371.1 Gene:rab10 / 100145267 XenbaseID:XB-GENE-5947409 Length:200 Species:Xenopus tropicalis


Alignment Length:205 Identity:162/205 - (79%)
Similarity:177/205 - (86%) Gaps:7/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDT 65
            ||||||||||||||||||||||||:|||||||||.:|||||||||||||||||:|||||||||||
 Frog     1 MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDT 65

  Fly    66 AGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKR 130
            ||||||||||||||||||||||||||||.||||||.|||||||||||||||:|:|||||||.|||
 Frog    66 AGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKR 130

  Fly   131 VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRE-SAENQERVIIDRRNQE 194
            ||.|.:||.|||||||||.|||||:|:|||:||..|||.||.||..:| ::||     :|..:..
 Frog   131 VVPKAKGEQIAREHGIRFFETSAKANVNIEKAFLTLAEDILRKTPVKEPNSEN-----VDISSGG 190

  Fly   195 KAPGY-SKCC 203
            ...|: ||||
 Frog   191 GVTGWKSKCC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 145/165 (88%)
rab10XP_031757371.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 145/165 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 288 1.000 Domainoid score I1553
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 309 1.000 Inparanoid score I2575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - oto102375
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.