DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab8b

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001092729.1 Gene:rab8b / 100093706 ZFINID:ZDB-GENE-070620-16 Length:209 Species:Danio rerio


Alignment Length:205 Identity:137/205 - (66%)
Similarity:165/205 - (80%) Gaps:7/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68
            ||||.||||||||||||||||:|||||:|||.:||||||||||||:|:||.||||||||||||||
Zfish     3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQ 67

  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
            |||.||||:||||||||||||||||||||:||..|:|||:|||:.|||:|||||||||.|||.|:
Zfish    68 ERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVS 132

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQER------VIIDRRN 192
            |||||.:|.::||:|:||||||:.|:|.||..||..|:.:.: |:..||...      .:....:
Zfish   133 KERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLN-RKMNENNPSGGGGGGAVKITES 196

  Fly   193 QEKAPGYSKC 202
            :.|.|.:.:|
Zfish   197 RSKKPSFFRC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 128/165 (78%)
rab8bNP_001092729.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 128/165 (78%)
RAB 9..172 CDD:197555 126/162 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.