DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and rab8b

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001090677.1 Gene:rab8b / 100036650 XenbaseID:XB-GENE-480278 Length:207 Species:Xenopus tropicalis


Alignment Length:196 Identity:135/196 - (68%)
Similarity:162/196 - (82%) Gaps:15/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQ 68
            ||||.||||||||||||||||:|||||:|||.:||||||||||||:|:||.||||||||||||||
 Frog     3 KTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQ 67

  Fly    69 ERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVN 133
            |||.||||:||||||||||||||||||||:||..|:|||:|||:.|||:|||||||||.|||.|:
 Frog    68 ERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVS 132

  Fly   134 KERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERVIIDRR-NQEKAP 197
            :|:||.:|.::||:|:||||||:||:|.||..||..|:.|              ::|: |:..:|
 Frog   133 REKGEKLAIDYGIKFLETSAKSSINVEEAFFTLARDIMTK--------------LNRKMNESISP 183

  Fly   198 G 198
            |
 Frog   184 G 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 127/165 (77%)
rab8bNP_001090677.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 127/165 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.