DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab10 and si:dkey-16l2.16

DIOPT Version :9

Sequence 1:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_001339327.1 Gene:si:dkey-16l2.16 / 100003902 ZFINID:ZDB-GENE-141219-36 Length:209 Species:Danio rerio


Alignment Length:210 Identity:94/210 - (44%)
Similarity:138/210 - (65%) Gaps:8/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDT 65
            ||.|.|..|||||:||||.|||:.:|.||:|::|:.::|:|||:||||:|||:.|:::|||||||
Zfish     1 MAGKDYHHLFKLLIIGDSNVGKSSLLLRFADNSFSGSYITTIGVDFKIRTVEIDGERVKLQIWDT 65

  Fly    66 AGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKR 130
            ||||||.|||::|||...|:::|||:||.:||.|:.:||..|.::. ::|.|:::|||.|...|:
Zfish    66 AGQERFRTITSTYYRNTHGVIIVYDVTNPESFVNVKRWLNEISQNC-DNVCKILVGNKNDDPSKK 129

  Fly   131 VVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGRESAENQERV-------II 188
            :|:.:.........|:|..|||||.|||:|..|......:|......:|...:||.       |.
Zfish   130 LVDTQDAMRFGESVGVRLFETSAKENINVEEMFMAFTHMVLRAKKQSQSRAEREREREKDTVHIN 194

  Fly   189 DRRNQEKAPGYSKCC 203
            ..|::|:.....|||
Zfish   195 SHRDRERRKKGKKCC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 81/165 (49%)
si:dkey-16l2.16XP_001339327.1 P-loop_NTPase 4..209 CDD:328724 90/205 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.