DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Abtb2

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_849221.2 Gene:Abtb2 / 99382 MGIID:2139365 Length:1024 Species:Mus musculus


Alignment Length:157 Identity:37/157 - (23%)
Similarity:71/157 - (45%) Gaps:11/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLP---DKTDPIVIPDVQPEA 79
            :.|::::.:|..|||..    :|...||:||..||..|:.:......   |.:..|.|.|::...
Mouse   836 HFLNNKEMSDVTFLVEG----KLFYAHKVLLVTASNRFKTLMTNKSEQDGDSSKTIEISDIKYHI 896

  Fly    80 FEAMLEYIY---TDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKL 141
            |:.:::|:|   |:.:.|.:.| ..:|...|..:.|..:...|.......||.::|...|::||:
Mouse   897 FQMLMQYLYYGGTESMEIPTAD-ILQLLSAANLFQLDALQRHCEILCSQTLSVESAVNTYKYAKI 960

  Fly   142 FDEPRLMQSSMDLIAANTREVLSDPSF 168
            .:.|.|..........:.:.:|...:|
Mouse   961 HNAPELALFCEGFFLKHMKALLEQDAF 987

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 27/109 (25%)
BTB 27..127 CDD:197585 26/105 (25%)
BACK 136..>199 CDD:197943 7/33 (21%)
Abtb2NP_849221.2 H2A 194..>242 CDD:305064
Ank_4 <498..542 CDD:290365
ANK 516..670 CDD:238125
ANK 1 521..550
ANK repeat 524..565 CDD:293786
Ank_2 526..633 CDD:289560
ANK repeat 567..604 CDD:293786
ANK 2 567..596
ANK 3 606..635
ANK repeat 606..631 CDD:293786
Ank_2 611..>679 CDD:289560
ANK repeat 649..679 CDD:293786
ANK 4 649..678
BTB 836..939 CDD:279045 26/107 (24%)
BTB 845..946 CDD:197585 26/105 (25%)
SPOP_C_like 946..>990 CDD:269810 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833899
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.