DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and AT4G08455

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_680660.3 Gene:AT4G08455 / 826404 AraportID:AT4G08455 Length:270 Species:Arabidopsis thaliana


Alignment Length:195 Identity:49/195 - (25%)
Similarity:85/195 - (43%) Gaps:28/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDK-TDPIVIPDVQPEAFEAMLEYIYTDRITIGS 96
            ||.|    |..||.:|...||||:.|....:.:. :..|.|.||..:|....:.|:||....:..
plant   103 GSPP----IPAHKSVLVSRSPVFKAMLENEMEESLSGTIKISDVSYDALRTFVYYLYTAEACLDE 163

  Fly    97 FDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDEPRLMQSSMDLIAANTRE 161
             ..||:|..:::||.:.|:.:.|..||...|||.|:...|.||...:...::.:::..|..|..:
plant   164 -QMACDLLVMSEKY
QVKHLKSYCERFLVTKLSPDNSLMTYAFAHQHNAKHVLDAALSQIVENMDK 227

  Fly   162 VLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLKFASERGILNESGQEETASGGQVLTKES 226
            :.....::::       :....||.:    :::...|           |.|..||:||...:|.|
plant   228 LTKREEYMEL-------VEKDPRLIV----EIYEAYL-----------SKQVNTAAGGTSTSKTS 270

  Fly   227  226
            plant   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 27/90 (30%)
BTB 27..127 CDD:197585 29/94 (31%)
BACK 136..>199 CDD:197943 7/62 (11%)
AT4G08455NP_680660.3 BTB_POZ_ZBTB_KLHL-like 90..176 CDD:349497 23/77 (30%)
BACK 194..248 CDD:350515 10/64 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.