DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Btbd17

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_017170266.1 Gene:Btbd17 / 72014 MGIID:1919264 Length:485 Species:Mus musculus


Alignment Length:390 Identity:80/390 - (20%)
Similarity:139/390 - (35%) Gaps:96/390 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LKDRGQYLLHSEKWADCRFLVGSSPTQ--RLIAGHKLLLAMASPVFERMFYGN----LPDKTDPI 70
            |..|.|.||.....:|....|.:..|.  |....|:|||.:.|.:|..:....    |.:..|..
Mouse    56 LLQRLQDLLRQGNASDVILRVQAVGTDEVRAFHTHRLLLGLHSELFRELLSNQSEVMLRESRDCA 120

  Fly    71 VIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLS----PKN 131
            .:       |:..:.|:|...:|: ...:|..|..:|.||.:..:......::.|.|:    |  
Mouse   121 AV-------FDKFIRYLYCGELTV-LLAQAIPLHRLATKYRVASLQRGVADYMRAHLAGGVGP-- 175

  Fly   132 ACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNC 196
            |...|.:|....:..|.:|.:..:|.|...|.....:..:....|..:|.::.|.:..||:||:.
Mouse   176 AVGWYHYAVSTGDEALRESCLQFLAWNLSAVAGSAEWGAVSPELLAQLLQRSDLVLQDELELFHA 240

  Fly   197 LLKF---------ASERGI-------LNESGQEETASGGQVLTKESPDNAAGHVLVEEIK----- 240
            |..:         .:||.:       :..:...:..:....|.:..|  |...:|::..:     
Mouse   241 LEAWLGRARPPPTVAERALRAIRYPMIPPAQLFQLQARSAALARHGP--AVADLLLQAYQFHAAS 303

  Fly   241 --------------------MEPDVAA--MVQHMHQDDEADSFET-------DAGMASTSSA--- 273
                                :.|...|  ::.:..:||.:.||:|       |||...|.:.   
Mouse   304 PLHYAKFFHVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRITWNVLFS 368

  Fly   274 ------------AAAAAAAPTAASPPLDVASGSDDLVIIDSDASADAAANMINIMDAQRTILDGA 326
                        |.||..|..||.|    ..|...||:..:.:..|||.     :..|:|:|.||
Mouse   369 PRWLPVSLRPVYADAAGTALPAARP----EDGRPRLVVTPASSGGDAAG-----VSFQKTVLVGA 424

  Fly   327  326
            Mouse   425  424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 23/109 (21%)
BTB 27..127 CDD:197585 22/105 (21%)
BACK 136..>199 CDD:197943 15/62 (24%)
Btbd17XP_017170266.1 BTB_POZ 67..165 CDD:365784 21/105 (20%)
BACK_BTBD17 173..245 CDD:350568 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.