DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Kbtbd4

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001298045.1 Gene:Kbtbd4 / 67136 MGIID:1914386 Length:534 Species:Mus musculus


Alignment Length:255 Identity:55/255 - (21%)
Similarity:99/255 - (38%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDRG----------QYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKT 67
            |||.          :..|..|.:||....|.....|.    |:|:|:..|..|..||..||.:..
Mouse    38 KDRSHSGRVAQGIMKLCLEEELFADVTISVEGREFQL----HRLVLSAQSCFFRSMFTSNLKEAH 98

  Fly    68 D-PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKN 131
            : .||:.||....|:.:::|||...:.:.: |:..|:..|:..|.|..:...|:.||...:...|
Mouse    99 NRVIVLQDVSESVFQLLVDYIYHGTVKLRA-DELQEIYEVSDMYQLTSLFEECSRFLARTVQVGN 162

  Fly   132 ACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNC 196
            ..:....|....:|.|..::......:..::.|...||.:....|..|:........:..:....
Mouse   163 CLQVMWLADRHSDPELYTAAKHCAKTHLAQLQSTEEFLHLPHHLLTDIISDGVPCSQNPTEAIEA 227

  Fly   197 LLKFASERGILNESGQEETASGGQVLTKESPDNAAGHVLVEEIKMEPDVAAMVQHMHQDD 256
            .:.|       |:..:|..|...:...||..:|...:::.:|......:|..: |..:||
Mouse   228 WINF-------NKEEREAFAESLRTSLKEIGENVHIYLIGKESSRTHSLAVSL-HCAEDD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 29/104 (28%)
BTB 27..127 CDD:197585 28/100 (28%)
BACK 136..>199 CDD:197943 8/62 (13%)
Kbtbd4NP_001298045.1 BTB 55..154 CDD:279045 29/103 (28%)
BTB 62..156 CDD:197585 28/98 (29%)
BACK_like 158..216 CDD:269806 9/57 (16%)
Kelch_2 294..330 CDD:284956
KELCH repeat 295..330 CDD:276965
Kelch 1 302..344
KELCH repeat 334..381 CDD:276965
Kelch 2 347..394
mutarot_permut 370..>527 CDD:274642
KELCH repeat 384..430 CDD:276965
Kelch 3 396..446
KELCH repeat 438..483 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.