DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and btbd3a

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001139053.1 Gene:btbd3a / 563691 ZFINID:ZDB-GENE-090312-7 Length:461 Species:Danio rerio


Alignment Length:198 Identity:76/198 - (38%)
Similarity:109/198 - (55%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DWQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTD 68
            :||.....:::|...:.::|..||..|:||.....:.:.|||.:||:.|.||..||||.|.:..|
Zfish    37 NWQGLYPTIRERNSVMFNNELMADIHFVVGPPGGTQRVPGHKYVLAVGSSVFHAMFYGELAEDKD 101

  Fly    69 PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNAC 133
            .|.||||:|.:|.|||:|||.|.|.:.: |......|.||||::||:...|.:||...||.:|||
Zfish   102 EIRIPDVEPPSFLAMLKYIYCDEIDLCA-DTVLATLYAAKKYIVPHLARACVNFLETSLSARNAC 165

  Fly   134 RAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLL 198
            .....:.||:||.|.|...::|.|.....|....|.||:..||.:||.:..||. .|:.:|...|
Zfish   166 VLLSQSCLFEEPDLTQRCWEVIDAQAELALRSEGFCDIDTQTLESILRRETLNA-KEMVVFEATL 229

  Fly   199 KFA 201
            .:|
Zfish   230 SWA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 44/103 (43%)
BTB 27..127 CDD:197585 44/99 (44%)
BACK 136..>199 CDD:197943 20/62 (32%)
btbd3aNP_001139053.1 BTB 52..155 CDD:279045 44/103 (43%)
BTB 60..159 CDD:197585 44/99 (44%)
BACK 165..271 CDD:197943 23/69 (33%)
PHR 316..459 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.