Sequence 1: | NP_608379.1 | Gene: | CG17068 / 33024 | FlyBaseID: | FBgn0031098 | Length: | 694 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139053.1 | Gene: | btbd3a / 563691 | ZFINID: | ZDB-GENE-090312-7 | Length: | 461 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 76/198 - (38%) |
---|---|---|---|
Similarity: | 109/198 - (55%) | Gaps: | 2/198 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DWQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTD 68
Fly 69 PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNAC 133
Fly 134 RAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLL 198
Fly 199 KFA 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17068 | NP_608379.1 | BTB | 19..123 | CDD:279045 | 44/103 (43%) |
BTB | 27..127 | CDD:197585 | 44/99 (44%) | ||
BACK | 136..>199 | CDD:197943 | 20/62 (32%) | ||
btbd3a | NP_001139053.1 | BTB | 52..155 | CDD:279045 | 44/103 (43%) |
BTB | 60..159 | CDD:197585 | 44/99 (44%) | ||
BACK | 165..271 | CDD:197943 | 23/69 (33%) | ||
PHR | 316..459 | CDD:285277 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170576634 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.800 |