DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and btbd3b

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_003199784.1 Gene:btbd3b / 562593 ZFINID:ZDB-GENE-041210-282 Length:517 Species:Danio rerio


Alignment Length:253 Identity:94/253 - (37%)
Similarity:132/253 - (52%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DWQNGLTELKDRGQYLLHSEKWADCRFLVG-SSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKT 67
            :||...:.:::|...:.::|..||..|:|| |..|||| .|||.:||:.|.||..||||.|.:.|
Zfish    93 NWQGLYSTIRERNSVMFNNELMADVHFVVGQSGGTQRL-PGHKYVLAVGSSVFHAMFYGELAEDT 156

  Fly    68 DPIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNA 132
            |.|.||||:|.||.|||:|||.|.|.: |.|......|.||||::||:...|.:||...||.|||
Zfish   157 DEIRIPDVEPPAFLAMLKYIYCDEIDL-SADTVLATLYAAKKYIVPHLARACVNFLETSLSAKNA 220

  Fly   133 CRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCL 197
            |.....:.||:||.|.|...::|.|.....|....|.||:..||.:||.:..||. .|:.:|...
Zfish   221 CILLSQSCLFEEPDLTQRCWEVIDAQAELALKSDGFCDIDSQTLESILRRETLNA-KEIVVFEAA 284

  Fly   198 LKFA--------------SERGILNES---------GQEETASG----GQVLTKESPD 228
            |.:|              ::|.:|.:|         |.::.|:|    |.:...|:.|
Zfish   285 LSWADAECQRREMNTSIDNKRKVLGQSIYLIRIPTMGLDDFANGAAQSGVLTLNETND 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 52/104 (50%)
BTB 27..127 CDD:197585 52/100 (52%)
BACK 136..>199 CDD:197943 20/62 (32%)
btbd3bXP_003199784.1 BTB 108..211 CDD:279045 52/104 (50%)
BTB 116..215 CDD:197585 52/100 (52%)
BACK 221..327 CDD:197943 27/106 (25%)
PHR 372..515 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576625
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.