Sequence 1: | NP_608379.1 | Gene: | CG17068 / 33024 | FlyBaseID: | FBgn0031098 | Length: | 694 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003199784.1 | Gene: | btbd3b / 562593 | ZFINID: | ZDB-GENE-041210-282 | Length: | 517 | Species: | Danio rerio |
Alignment Length: | 253 | Identity: | 94/253 - (37%) |
---|---|---|---|
Similarity: | 132/253 - (52%) | Gaps: | 31/253 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DWQNGLTELKDRGQYLLHSEKWADCRFLVG-SSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKT 67
Fly 68 DPIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNA 132
Fly 133 CRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCL 197
Fly 198 LKFA--------------SERGILNES---------GQEETASG----GQVLTKESPD 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17068 | NP_608379.1 | BTB | 19..123 | CDD:279045 | 52/104 (50%) |
BTB | 27..127 | CDD:197585 | 52/100 (52%) | ||
BACK | 136..>199 | CDD:197943 | 20/62 (32%) | ||
btbd3b | XP_003199784.1 | BTB | 108..211 | CDD:279045 | 52/104 (50%) |
BTB | 116..215 | CDD:197585 | 52/100 (52%) | ||
BACK | 221..327 | CDD:197943 | 27/106 (25%) | ||
PHR | 372..515 | CDD:285277 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170576625 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2075 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.700 |