DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and KBTBD4

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001305645.1 Gene:KBTBD4 / 55709 HGNCID:23761 Length:567 Species:Homo sapiens


Alignment Length:255 Identity:53/255 - (20%)
Similarity:99/255 - (38%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDRG----------QYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKT 67
            |||.          :..|..|.:||....|.....|.    |:|:|:..|..|..||..||.:..
Human    71 KDRSHSGRVAQGIMKLCLEEELFADVTISVEGREFQL----HRLVLSAQSCFFRSMFTSNLKEAH 131

  Fly    68 D-PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKN 131
            : .||:.||....|:.:::|||...:.:.: ::..|:..|:..|.|..:...|:.||...:...|
Human   132 NRVIVLQDVSESVFQLLVDYIYHGTVKLRA-EELQEIYEVSDMYQLTSLFEECSRFLARTVQVGN 195

  Fly   132 ACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNC 196
            ..:....|....:|.|..::......:..::.:...||.:....|..|:........:..:....
Human   196 CLQVMWLADRHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHRLLTDIISDGVPCSQNPTEAIEA 260

  Fly   197 LLKFASERGILNESGQEETASGGQVLTKESPDNAAGHVLVEEIKMEPDVAAMVQHMHQDD 256
            .:.|       |:..:|..|...:...||..:|...:::.:|......:|..: |..:||
Human   261 WINF-------NKEEREAFAESLRTSLKEIGENVHIYLIGKESSRTHSLAVSL-HCAEDD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 28/104 (27%)
BTB 27..127 CDD:197585 27/100 (27%)
BACK 136..>199 CDD:197943 7/62 (11%)
KBTBD4NP_001305645.1 BTB 88..187 CDD:279045 28/103 (27%)
BTB 95..189 CDD:197585 27/98 (28%)
BACK_like 191..249 CDD:269806 8/57 (14%)
Kelch_2 327..363 CDD:284956
KELCH repeat 328..363 CDD:276965
KELCH repeat 367..414 CDD:276965
mutarot_permut 403..>560 CDD:274642
KELCH repeat 417..463 CDD:276965
KELCH repeat 471..516 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.