DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and KLHL11

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_060613.1 Gene:KLHL11 / 55175 HGNCID:19008 Length:708 Species:Homo sapiens


Alignment Length:236 Identity:58/236 - (24%)
Similarity:95/236 - (40%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RLIAGHKLLLAMASPVFERMFYGNLPDKTDPIV-------IPDVQPEAFEAMLEYIYTDRITI-- 94
            |....|:.:||.|:..|..:..|...:.....|       .|..:|:..||::||:||.||.:  
Human   106 REFRAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVST 170

  Fly    95 GSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDEPRLMQSSMDLIAANT 159
            ||..:..||   |.:::|..:...|..||...|...|....:..|.::...:|...:.|:|..|.
Human   171 GSVHEVLEL---ADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNF 232

  Fly   160 REVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLKFASERGILNESGQEETASGGQVLTK 224
            .:|:.|..|..:....:...|....:.:|||..||..:||:........|...||.....: |::
Human   233 HKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLR-LSQ 296

  Fly   225 ESPDNAAGHVLVEEIKMEPDVAAMVQHMHQDDEADSFETDA 265
            ..|.....||..|.:....:|...:       .||:.|..|
Human   297 MKPTYLTRHVKPERLVANNEVCVKL-------VADAVERHA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 25/92 (27%)
BTB 27..127 CDD:197585 27/96 (28%)
BACK 136..>199 CDD:197943 14/62 (23%)
KLHL11NP_060613.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..70
BTB_POZ_KLHL11 71..205 CDD:349550 28/101 (28%)
PHA03098 90..553 CDD:222983 58/236 (25%)
BACK_KLHL11 200..287 CDD:350526 19/86 (22%)
Kelch 1 360..407
KELCH repeat 399..439 CDD:276965
Kelch 2 408..453
KELCH repeat 443..488 CDD:276965
Kelch 3 455..501
KELCH repeat 491..541 CDD:276965
Kelch 4 503..556
KELCH repeat 567..649 CDD:276965
Kelch 5 610..661
Kelch 611..657 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.