Sequence 1: | NP_608379.1 | Gene: | CG17068 / 33024 | FlyBaseID: | FBgn0031098 | Length: | 694 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038959853.1 | Gene: | RGD1560554 / 502576 | RGDID: | 1560554 | Length: | 364 | Species: | Rattus norvegicus |
Alignment Length: | 201 | Identity: | 54/201 - (26%) |
---|---|---|---|
Similarity: | 78/201 - (38%) | Gaps: | 39/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 WQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMF-YGNLPDKTD 68
Fly 69 PIVIPDVQPEAFEAMLEYIYTDRIT-IGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNA 132
Fly 133 CRAYEFAKLFDEPRLMQSSMDLIAANTREV---------------LSDPSFL---DIEVSTLMAI 179
Fly 180 LDQNRL 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17068 | NP_608379.1 | BTB | 19..123 | CDD:279045 | 31/105 (30%) |
BTB | 27..127 | CDD:197585 | 32/101 (32%) | ||
BACK | 136..>199 | CDD:197943 | 15/68 (22%) | ||
RGD1560554 | XP_038959853.1 | MATH | 16..153 | CDD:351761 | |
BTB_POZ | 165..292 | CDD:365784 | 38/128 (30%) | ||
BACK | 287..352 | CDD:421692 | 16/64 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166337460 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |