DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and lute

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001262663.1 Gene:lute / 42089 FlyBaseID:FBgn0262871 Length:735 Species:Drosophila melanogaster


Alignment Length:536 Identity:128/536 - (23%)
Similarity:202/536 - (37%) Gaps:152/536 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DIDWQNGLTELKDRGQYLLHSEKWADCRFLVGS----SPTQRLIAGHKLLLAMASPVFERMFYGN 62
            |.:||.....:.:|...:.::|..:|.:|:||.    .|.| .|..||.:||..|.||..||||.
  Fly   188 DPNWQASKATVLERNAAMFNNELMSDVKFIVGGEFDIDPIQ-TIPAHKYILATGSSVFYAMFYGG 251

  Fly    63 LPDKTDPIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADL 127
            |.:....|.:|||:|.||..:|.|:|.|.|.:.. :......|.||||::||:...|.::|...|
  Fly   252 LAENKQEIKVPDVEPTAFLTLLRYLYCDEIKLEP-EHILATLYAAKKYIVPHLARACVNYLEVKL 315

  Fly   128 SPKNACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELD 192
            :.||||.....::||:||.|||...::|.|.....:....|:||::.|..:||.:..||. .|:.
  Fly   316 TAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRETLNC-KEIH 379

  Fly   193 LFNCLLKFA--------------SERGILNES---------GQEETASG----GQVLTKESPDNA 230
            ||...|.:|              ::|.:|.::         ..||.|:|    |.:.::|:.|  
  Fly   380 LFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRIPTMSLEEFANGVAQTGILSSQETID-- 442

  Fly   231 AGHVLVEEIKMEPDVA----------AMVQHMHQD-----------DEADS--FETDA------- 265
              ..|....||:|.:.          ..|.|..|.           ...||  |..|.       
  Fly   443 --MFLHFTAKMKPSLGFPTRSRAGLKTQVCHRFQSCAYRSNQWRYRGRCDSIQFSVDRRIFIVGF 505

  Fly   266 GMASTSSAAAAAAAAPTAASPPLDVASGSDDLVIIDSDASADAAANMINIM------------DA 318
            |:..:|:.||       ..:..:::......|...|:...:|.::|..::.            ..
  Fly   506 GLYGSSTGAA-------NYNVKIELKRLGRTLAENDTKFFSDGSSNTFHVFFENPIQIEPECYYT 563

  Fly   319 QRTILDGAML----RQAVKKIRFLTMT--------------------PQQFAEGPARSKLLQQHE 359
            ...||||..|    ::.:.::....:|                    |:....||          
  Fly   564 ASVILDGNELSFFGQEGMSEVLMGNVTFQFQCSSESTNGTGVQGGQIPELIFYGP---------- 618

  Fly   360 ALSILIKISSPSLNDCHMPEGFCVSRSTRNFYESGHRHAQRELSSSYRTGA---APSGVCFP--- 418
              :.:..:|||:.:.|..|.|                      .||...||   |.:|...|   
  Fly   619 --TTVTAMSSPTNSLCPTPIG----------------------GSSSNAGATSTAAAGTAVPNSS 659

  Fly   419 -GPGPAVRSGGPSGGG 433
             |.|....|.|..|.|
  Fly   660 NGSGNNANSSGEDGDG 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 40/107 (37%)
BTB 27..127 CDD:197585 40/103 (39%)
BACK 136..>199 CDD:197943 20/62 (32%)
luteNP_001262663.1 BTB 204..311 CDD:279045 40/108 (37%)
BTB 213..315 CDD:197585 40/103 (39%)
BACK 321..427 CDD:197943 27/106 (25%)
PHR 472..615 CDD:285277 20/149 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45774
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.