DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Btbd6

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_964008.2 Gene:Btbd6 / 399566 MGIID:3026623 Length:539 Species:Mus musculus


Alignment Length:252 Identity:81/252 - (32%)
Similarity:124/252 - (49%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DWQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTD 68
            :||:....|::|...:.::|..||..|:||:....|.:..||.:||:.|.||..||||:|.:...
Mouse   115 NWQSFHPTLRERNALMFNNELMADVHFIVGALGAARRVPAHKYVLAVGSSVFYAMFYGDLAEVKS 179

  Fly    69 PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNAC 133
            .|.||||:|.||..:|:|:|:|.|.:.: |......|.||||::|.:...|.:||...|..||||
Mouse   180 EIHIPDVEPAAFLVLLKYMYSDEIDLEA-DTVLATLYAAKKYIVPALAKACVNFLETSLEAKNAC 243

  Fly   134 RAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLL 198
            .....::||:||.|.|...::|.|.....|....|.:|:..||..|:.:..|| ..|..:|..:|
Mouse   244 VLLSQSRLFEEPELTQRCWEVIDAQAEMALRSEGFCEIDRQTLEIIVTREALN-TKEAVVFEAVL 307

  Fly   199 KFA--------------SERGILNES---------GQEETASG---GQVLTKESPDN 229
            .:|              ::|.:|..:         ..||.|:|   ..:||.|...|
Mouse   308 NWAEAECKRQGLPVTPHNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTLEETHN 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 40/103 (39%)
BTB 27..127 CDD:197585 40/99 (40%)
BACK 136..>199 CDD:197943 18/62 (29%)
Btbd6NP_964008.2 BTB 130..233 CDD:279045 40/103 (39%)
BTB 138..237 CDD:197585 40/99 (40%)
BACK 243..349 CDD:197943 25/106 (24%)
PHR 394..537 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833890
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.