Sequence 1: | NP_608379.1 | Gene: | CG17068 / 33024 | FlyBaseID: | FBgn0031098 | Length: | 694 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_964008.2 | Gene: | Btbd6 / 399566 | MGIID: | 3026623 | Length: | 539 | Species: | Mus musculus |
Alignment Length: | 252 | Identity: | 81/252 - (32%) |
---|---|---|---|
Similarity: | 124/252 - (49%) | Gaps: | 28/252 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DWQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTD 68
Fly 69 PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNAC 133
Fly 134 RAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLL 198
Fly 199 KFA--------------SERGILNES---------GQEETASG---GQVLTKESPDN 229 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17068 | NP_608379.1 | BTB | 19..123 | CDD:279045 | 40/103 (39%) |
BTB | 27..127 | CDD:197585 | 40/99 (40%) | ||
BACK | 136..>199 | CDD:197943 | 18/62 (29%) | ||
Btbd6 | NP_964008.2 | BTB | 130..233 | CDD:279045 | 40/103 (39%) |
BTB | 138..237 | CDD:197585 | 40/99 (40%) | ||
BACK | 243..349 | CDD:197943 | 25/106 (24%) | ||
PHR | 394..537 | CDD:285277 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833890 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2075 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
4 | 3.700 |