DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and spop

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_989003.1 Gene:spop / 394599 XenbaseID:XB-GENE-1003310 Length:374 Species:Xenopus tropicalis


Alignment Length:183 Identity:52/183 - (28%)
Similarity:85/183 - (46%) Gaps:15/183 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDIDWQNGLTELK-------DRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERM 58
            ::|..||.:..:|       |....|..:.::.||...|.....|    .||.:||..||||..|
 Frog   168 VNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQ----AHKAILAARSPVFSAM 228

  Fly    59 FYGNLPD-KTDPIVIPDVQPEAFEAMLEYIYTDRITIGSFDK-ACELCYVAKKYMLPHVVTRCTH 121
            |...:.: |.:.:.|.||:|:.|:.|:.:|||.:.:  :.|| |.:|...|.||.|..:...|..
 Frog   229 FEHEMEESKKNRVEIKDVEPDVFKEMMCFIYTGKAS--NLDKMADDLLAAADKYALERLKVMCEE 291

  Fly   122 FLWADLSPKNACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVS 174
            .|.::||.:||......|.|....:|...::|.|..:..:|:....:..:.||
 Frog   292 ALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVMETSGWKSMVVS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 34/105 (32%)
BTB 27..127 CDD:197585 34/101 (34%)
BACK 136..>199 CDD:197943 8/39 (21%)
spopNP_989003.1 MATH_SPOP 28..166 CDD:239743
Required for nuclear localization. /evidence=ECO:0000250 71..191 5/22 (23%)
BTB_POZ_SPOP-like 182..301 CDD:349588 38/124 (31%)
BACK_SPOP 297..367 CDD:350593 12/48 (25%)
Homodimerization. /evidence=ECO:0000250 297..355 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.