DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and kbtbd4

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_956503.1 Gene:kbtbd4 / 393178 ZFINID:ZDB-GENE-040426-937 Length:522 Species:Danio rerio


Alignment Length:268 Identity:55/268 - (20%)
Similarity:99/268 - (36%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDIDWQNGLTELKDRGQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPD 65
            ||:..::||               :||....|.|...|.    |:|:|:..|..|..||..||.:
Zfish    39 MDLCLEDGL---------------FADVIVTVDSKEFQL----HRLVLSAQSSFFRSMFTSNLRE 84

  Fly    66 KTD-PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSP 129
            ..| .|.:.||....|:::::|||...|.:...|.. :...:|..|.|..:...|:.||...:..
Zfish    85 AYDRNIELKDVSATVFQSLVDYIYHGMIKLRVEDLQ-DTYEMADMYQLTALFEECSRFLSRTVDV 148

  Fly   130 KNACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAI--------------- 179
            :|..:....|....:..|..::......:..::.....||::.:..||.|               
Zfish   149 RNCLQVMWLADRHSDQELYTAAKHCAKIHLVQLHQTDEFLNLPLCLLMDIIKDGVPSSQNPTAAI 213

  Fly   180 ---LDQNRLNIDSELDLFNCLLKFASERGILNESGQEETASGGQVLTKESPDNAAGHVLVEEIKM 241
               ::.|::..:...|:....||...|:..:...|:|:|.:               |.|...:..
Zfish   214 ESWINHNKVEREEYSDMLLDSLKEIGEKVHIYLIGKEDTRT---------------HSLAVSLHC 263

  Fly   242 EPDVAAMV 249
            :.|.|..|
Zfish   264 DEDHAISV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 28/104 (27%)
BTB 27..127 CDD:197585 29/100 (29%)
BACK 136..>199 CDD:197943 9/80 (11%)
kbtbd4NP_956503.1 BTB 39..142 CDD:279045 32/122 (26%)
BTB 50..142 CDD:197585 27/96 (28%)
BACK 151..247 CDD:197943 12/95 (13%)
KELCH repeat 283..318 CDD:276965
KELCH repeat 322..369 CDD:276965
KELCH repeat 372..421 CDD:276965
KELCH repeat 424..471 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.