DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and BTBD17

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_011523093.1 Gene:BTBD17 / 388419 HGNCID:33758 Length:479 Species:Homo sapiens


Alignment Length:387 Identity:79/387 - (20%)
Similarity:147/387 - (37%) Gaps:96/387 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RGQYLLHSEKWADCRFLVGSSPTQ--RLIAGHKLLLAMASPVFERMFYGNLPDKTDPIVIPDVQP 77
            |.|.||.....:|....|.::.|.  |:...|:|||.:.|.:|..:    |.::::.::   .:|
Human    53 RLQELLRQGNASDVVLRVQAAGTDEVRVFHAHRLLLGLHSELFLEL----LSNQSEAVL---QEP 110

  Fly    78 E----AFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLS----PKNACR 134
            :    .|:..:.|:|...:|: ...:|..|..:|.||.:..:......::.|.|:    |  |..
Human   111 QDCAAVFDKFIRYLYCGELTV-LLTQAIPLHRLATKYGVSSLQRGVADYMRAHLAGGAGP--AVG 172

  Fly   135 AYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLK 199
            .|.:|....:..|.:|.:..:|.|...|.:...:..:....|..:|.::.|.:..||:||:.|..
Human   173 WYHYAVGTGDEALRESCLQFLAWNLSAVAASTEWGAVSPELLWQLLQRSDLVLQDELELFHALEA 237

  Fly   200 F---------ASERGI-------LNESGQEETASGGQVLTKESPDNAAGHVLVEEIK-------- 240
            :         .:||.:       :..:...:..:....|.:..|  |...:|::..:        
Human   238 WLGRARPPPAVAERALRAIRYPMIPPAQLFQLQARSAALARHGP--AVADLLLQAYQFHAASPLH 300

  Fly   241 -----------------MEPDVAA--MVQHMHQDDEADSFET-------DAGMASTSSA------ 273
                             :.|...|  ::.:..:||.:.||:|       |||...|.:.      
Human   301 YAKFFDVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLFSPRW 365

  Fly   274 ---------AAAAAAAPTAASPPLDVASGSDDLVIIDSDASADAAANMINIMDAQRTILDGA 326
                     |.||..|..||.|    ..|...||:..:.:..|||.     :..|:|:|.||
Human   366 LPVSLRPVYADAAGTALPAARP----EDGRPRLVVTPASSGGDAAG-----VSFQKTVLVGA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 23/109 (21%)
BTB 27..127 CDD:197585 22/105 (21%)
BACK 136..>199 CDD:197943 15/62 (24%)
BTBD17XP_011523093.1 BTB 54..159 CDD:279045 24/112 (21%)
BTB 65..163 CDD:197585 22/105 (21%)
BACK 170..268 CDD:197943 18/97 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.