DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and CG11714

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster


Alignment Length:376 Identity:85/376 - (22%)
Similarity:136/376 - (36%) Gaps:114/376 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SEKWADCRFLV-GSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTDPIV-IPDVQPEAFEAML 84
            :.:..||.|:: ..|...:....||||.:.||.||:||.||:..:.|..:| :.||||:.||...
  Fly    24 TNRHTDCTFIIEDESGGSQSFPCHKLLFSCASDVFDRMLYGDYIESTSGVVRLNDVQPDIFEKFR 88

  Fly    85 EYIY---TDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDEPR 146
            :|:|   .|::....||....||..|.||::..:...|...|   |..||.....|..:||....
  Fly    89 DYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCVKDL---LIRKNTFDMGELLRLFQCAH 150

  Fly   147 LM--QSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQN---RLNID-------------SELDL 193
            .|  :|.::.||...:             .|..:.||.:   ..|.:             ||.|.
  Fly   151 RMNRKSLINQIAWELK-------------CTFKSTLDHSGVYEFNCEVFKHYIEVIASKISEADR 202

  Fly   194 FNCLLKFASERGILNESGQEETASGGQVLTKESPD-NAAGHVLVEEIKMEPDVAAMVQHMHQDDE 257
            |..|..:....||      ||..|.|||.::::.: |........|::            :|:.|
  Fly   203 FRLLEMYLKYNGI------EELESAGQVDSQDATEANTTTITTTNEVE------------NQESE 249

  Fly   258 ADS-----FETDAGMASTSSAAAAAAAAPTAASPPLDVASGSDDLVIIDSDASADAAANMINIMD 317
            ..|     .:|:...|..:..|:..                ||.|.:||                
  Fly   250 LPSTSCVPLKTECSFAVPNKKASFV----------------SDLLALID---------------- 282

  Fly   318 AQRTILDGAMLRQAVKKIRFLTMTPQQFAEGPARSKLLQQHEALSILIKIS 368
                               |..::|::|.:||.:|..|...|....:.:|:
  Fly   283 -------------------FGKLSPKEFYDGPGKSNFLSLAEKYEHMYQIA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 35/105 (33%)
BTB 27..127 CDD:197585 36/104 (35%)
BACK 136..>199 CDD:197943 16/80 (20%)
CG11714NP_001027123.1 BTB 27..131 CDD:279045 36/106 (34%)
BTB 29..133 CDD:197585 37/106 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.