DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Tango10

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster


Alignment Length:262 Identity:52/262 - (19%)
Similarity:100/262 - (38%) Gaps:55/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 HKLLLAMASPVFERMFYGNLPDKTDPIVIPDVQPEA-----FEAMLEYIYTDRITIGSFDKACEL 103
            |:::|..:|.||:.|......::....|| ::..||     |...::|:|..:|.: :......:
  Fly   157 HRVILCASSDVFQVMLMNPEWNECSKHVI-ELHEEACCSAVFPQFIKYLYVGQIEV-TLQTVMPM 219

  Fly   104 CYVAKKYMLPHVVTRCTHFLWADLSPKNACRAY---------EFAKLFDEPRLMQSSMDLIAANT 159
            ..::.||.:..::..|..::...:: |.|...|         .|....::  |.::....:..|.
  Fly   220 LALSDKYNIRDLIDLCVDYMNKH
VA-KAATSGYLVSWLQYTLSFTPTHND--LTETLKRFLKWNL 281

  Fly   160 REVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNCLLKFASERGILNESGQEETASGGQVLTK 224
            ..|.....|::::.:.|:.:|.||.|.:.||..||:.|..:...|    ....|.|.|||.:   
  Fly   282 EMVAESRDFVEMDPAILILLLQQNDLVVTSEYKLFDILQTWLLHR----REQMEATGSGGFM--- 339

  Fly   225 ESPDNAAGHV-------------------------LVEEIKMEPDVAAMVQHMHQDDEADSFETD 264
            |..:....|:                         |||.|.    :....|..|:|...:...|:
  Fly   340 ELIEQTVSHIRFGMMTPRQLSHLLMDPLVEYHKEFLVERIA----IGMSYQSGHEDRVREVRATE 400

  Fly   265 AG 266
            :|
  Fly   401 SG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 17/83 (20%)
BTB 27..127 CDD:197585 17/87 (20%)
BACK 136..>199 CDD:197943 16/71 (23%)
Tango10NP_001259461.1 BTB 135..239 CDD:279045 17/83 (20%)
BTB 144..242 CDD:197585 17/86 (20%)
BACK 258..359 CDD:197943 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.