DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17068 and Kbtbd4

DIOPT Version :9

Sequence 1:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_017447204.1 Gene:Kbtbd4 / 311185 RGDID:1310234 Length:553 Species:Rattus norvegicus


Alignment Length:255 Identity:55/255 - (21%)
Similarity:100/255 - (39%) Gaps:24/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDRG----------QYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKT 67
            |||.          :..|..|.:||....|.....|.    |:|:|:..|..|..||..||.:..
  Rat    57 KDRSHSGRVAQGIMKLCLEEELFADVTISVEGREFQL----HRLVLSAQSCFFRSMFTSNLKEAH 117

  Fly    68 D-PIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKN 131
            : .||:.||....|:.:::|||...:.:.: |:..|:..|:..|.|..:...|:.||...:...|
  Rat   118 NRVIVLQDVSESVFQLLVDYIYHGTVKLRA-DELQEIYEVSDMYQLTSLFEECSRFLARTVQVGN 181

  Fly   132 ACRAYEFAKLFDEPRLMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNC 196
            ..:....|....:|.|..::......:..::.|...||.:....|..|:........:..:..:.
  Rat   182 CLQVMWLADRHSDPELYTAAKHCAKTHLAQLQSTEEFLHLPHHLLTDIISDGVPCSQNPTEAIDA 246

  Fly   197 LLKFASERGILNESGQEETASGGQVLTKESPDNAAGHVLVEEIKMEPDVAAMVQHMHQDD 256
            .:.|       |:..:|..|...:...||..:|...:::.:|......:|..: |..:||
  Rat   247 WINF-------NKEEREAFAESLRTSLKEIGENVHIYLIGKESSRTHSLAVSL-HCAEDD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17068NP_608379.1 BTB 19..123 CDD:279045 29/104 (28%)
BTB 27..127 CDD:197585 28/100 (28%)
BACK 136..>199 CDD:197943 8/62 (13%)
Kbtbd4XP_017447204.1 BTB_POZ_KBTBD4 48..187 CDD:349581 35/134 (26%)
PHA03098 82..514 CDD:222983 48/230 (21%)
BACK_KBTBD4 177..264 CDD:350556 13/93 (14%)
KELCH repeat 314..349 CDD:276965
KELCH repeat 353..400 CDD:276965
KELCH repeat 403..449 CDD:276965
KELCH repeat 457..502 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.